POP4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125083
Artikelname: POP4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125083
Hersteller Artikelnummer: orb2125083
Alternativnummer: BYT-ORB2125083-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POP4
Konjugation: FITC
Alternative Synonym: RPP29
POP4 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 006618
UniProt: O95707
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL