SRSF10 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125086
Artikelname: SRSF10 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125086
Hersteller Artikelnummer: orb2125086
Alternativnummer: BYT-ORB2125086-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUSIP1
Konjugation: FITC
Alternative Synonym: NSSR, TASR, SRp38, TASR1, TASR2, FUSIP1, FUSIP2, SFRS13, SRrp40, SFRS13A, PPP1R149
SRSF10 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 473357
UniProt: O75494
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP