SLBP Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125117
Artikelname: SLBP Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125117
Hersteller Artikelnummer: orb2125117
Alternativnummer: BYT-ORB2125117-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLBP
Konjugation: Biotin
Alternative Synonym: HBP
SLBP Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 006518
UniProt: Q14493
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK