SARS Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125119
Artikelname: SARS Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125119
Hersteller Artikelnummer: orb2125119
Alternativnummer: BYT-ORB2125119-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SARS
Konjugation: FITC
Alternative Synonym: SARS, SERS, SERRS, NEDMAS
SARS Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 006504
UniProt: Q5T5C8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL