SARS Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125123
Artikelname: SARS Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125123
Hersteller Artikelnummer: orb2125123
Alternativnummer: BYT-ORB2125123-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SARS
Konjugation: Biotin
Alternative Synonym: SARS, SERS, SERRS, NEDMAS
SARS Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 006504
UniProt: Q5T5C8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL