PRPF8 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125138
Artikelname: PRPF8 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125138
Hersteller Artikelnummer: orb2125138
Alternativnummer: BYT-ORB2125138-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF8
Konjugation: Biotin
Alternative Synonym: PRP8, RP13, HPRP8, PRPC8, SNRNP220
PRPF8 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 273kDa
NCBI: 006436
UniProt: Q6P2Q9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR