RNASEH2A Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125139
Artikelname: RNASEH2A Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125139
Hersteller Artikelnummer: orb2125139
Alternativnummer: BYT-ORB2125139-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A
Konjugation: HRP
Alternative Synonym: AGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
RNASEH2A Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 006388
UniProt: O75792
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE