RNASEH2A Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125140
Artikelname: RNASEH2A Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125140
Hersteller Artikelnummer: orb2125140
Alternativnummer: BYT-ORB2125140-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A
Konjugation: FITC
Alternative Synonym: AGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
RNASEH2A Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 006388
UniProt: O75792
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE