CHERP Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125151
Artikelname: CHERP Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125151
Hersteller Artikelnummer: orb2125151
Alternativnummer: BYT-ORB2125151-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHERP
Konjugation: HRP
Alternative Synonym: SRA1, DAN16, SCAF6
CHERP Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 006378
UniProt: Q8IWX8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD