CHERP Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125153
Artikelname: CHERP Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125153
Hersteller Artikelnummer: orb2125153
Alternativnummer: BYT-ORB2125153-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHERP
Konjugation: Biotin
Alternative Synonym: SRA1, DAN16, SCAF6
CHERP Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 006378
UniProt: Q8IWX8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD