SYNCRIP Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125160
Artikelname: SYNCRIP Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125160
Hersteller Artikelnummer: orb2125160
Alternativnummer: BYT-ORB2125160-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYNCRIP
Konjugation: HRP
Alternative Synonym: PP68, NSAP1, GRYRBP, HNRNPQ, HNRPQ1, GRY-RBP, hnRNP-Q
SYNCRIP Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 006363
UniProt: O60506
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG