SYNCRIP Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125162
Artikelname: SYNCRIP Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125162
Hersteller Artikelnummer: orb2125162
Alternativnummer: BYT-ORB2125162-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYNCRIP
Konjugation: Biotin
Alternative Synonym: PP68, NSAP1, GRYRBP, HNRNPQ, HNRPQ1, GRY-RBP, hnRNP-Q
SYNCRIP Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 006363
UniProt: O60506
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG