NXF1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125167
Artikelname: NXF1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125167
Hersteller Artikelnummer: orb2125167
Alternativnummer: BYT-ORB2125167-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXF1
Konjugation: FITC
Alternative Synonym: TAP, MEX67
NXF1 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 006353
UniProt: Q9UBU9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG