RBM14 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125177
Artikelname: RBM14 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125177
Hersteller Artikelnummer: orb2125177
Alternativnummer: BYT-ORB2125177-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM14
Konjugation: Biotin
Alternative Synonym: SIP, COAA, PSP2, SYTIP1, TMEM137
RBM14 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 006319
UniProt: Q96PK6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD