SFRS6 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125178
Artikelname: SFRS6 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125178
Hersteller Artikelnummer: orb2125178
Alternativnummer: BYT-ORB2125178-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS6
Konjugation: HRP
Alternative Synonym: B52, SFRS6, SRP55, HEL-S-91
SFRS6 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 006266
UniProt: Q13247
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS