SFRS6 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125180
Artikelname: SFRS6 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125180
Hersteller Artikelnummer: orb2125180
Alternativnummer: BYT-ORB2125180-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS6
Konjugation: Biotin
Alternative Synonym: B52, SFRS6, SRP55, HEL-S-91
SFRS6 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 006266
UniProt: Q13247
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS