PCBP1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2125186
Artikelname: |
PCBP1 Antibody - middle region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2125186 |
Hersteller Artikelnummer: |
orb2125186 |
Alternativnummer: |
BYT-ORB2125186-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PCBP1 |
Konjugation: |
Biotin |
Alternative Synonym: |
HNRPX, HNRPE1, hnRNP-X, HEL-S-85, hnRNP-E1 |
PCBP1 Antibody - middle region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
39kDa |
NCBI: |
006187 |
UniProt: |
Q15365 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM |