PCBP1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125186
Artikelname: PCBP1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125186
Hersteller Artikelnummer: orb2125186
Alternativnummer: BYT-ORB2125186-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCBP1
Konjugation: Biotin
Alternative Synonym: HNRPX, HNRPE1, hnRNP-X, HEL-S-85, hnRNP-E1
PCBP1 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 006187
UniProt: Q15365
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM