RACK1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125200
Artikelname: RACK1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125200
Hersteller Artikelnummer: orb2125200
Alternativnummer: BYT-ORB2125200-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNB2L1
Konjugation: FITC
Alternative Synonym: H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1
RACK1 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 006089
UniProt: P63244
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI