RBM12 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125203
Artikelname: RBM12 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125203
Hersteller Artikelnummer: orb2125203
Alternativnummer: BYT-ORB2125203-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM12
Konjugation: FITC
Alternative Synonym: SWAN, SCZD19, HRIHFB2091
RBM12 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 006038
UniProt: Q9NTZ6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG