RBM12 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2125205
Artikelname: RBM12 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2125205
Hersteller Artikelnummer: orb2125205
Alternativnummer: BYT-ORB2125205-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM12
Konjugation: HRP
Alternative Synonym: SWAN, SCZD19, HRIHFB2091
RBM12 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 006038
UniProt: Q9NTZ6
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR