AKAP7 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131447
Artikelname: AKAP7 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131447
Hersteller Artikelnummer: orb2131447
Alternativnummer: BYT-ORB2131447-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKAP7
Konjugation: FITC
Alternative Synonym: AKAP15, AKAP18
AKAP7 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 057461
UniProt: Q9P0M2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQV