ANXA10 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131448
Artikelname: ANXA10 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131448
Hersteller Artikelnummer: orb2131448
Alternativnummer: BYT-ORB2131448-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANXA10
Konjugation: Biotin
Alternative Synonym: ANX14
ANXA10 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 009124
UniProt: Q9UJ72
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE