RUNX2 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131463
Artikelname: RUNX2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131463
Hersteller Artikelnummer: orb2131463
Alternativnummer: BYT-ORB2131463-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX2
Konjugation: Biotin
Alternative Synonym: CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1
RUNX2 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 64kDa
UniProt: Q13950
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDRLSDLGRIPHPSMR