RUNX2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2131463
Artikelname: |
RUNX2 Antibody - middle region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2131463 |
Hersteller Artikelnummer: |
orb2131463 |
Alternativnummer: |
BYT-ORB2131463-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human RUNX2 |
Konjugation: |
Biotin |
Alternative Synonym: |
CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1 |
RUNX2 Antibody - middle region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
64kDa |
UniProt: |
Q13950 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: YHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDRLSDLGRIPHPSMR |