RUNX2 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131465
Artikelname: RUNX2 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131465
Hersteller Artikelnummer: orb2131465
Alternativnummer: BYT-ORB2131465-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX2
Konjugation: FITC
Alternative Synonym: CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1
RUNX2 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 64kDa
UniProt: Q13950
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDRLSDLGRIPHPSMR