SPP1 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131473
Artikelname: SPP1 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131473
Hersteller Artikelnummer: orb2131473
Alternativnummer: BYT-ORB2131473-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPP1
Konjugation: HRP
Alternative Synonym: OPN, BNSP, BSPI, ETA-1
SPP1 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 000573
UniProt: B2RDA1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ