MCM7 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2131520
| Artikelname: |
MCM7 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2131520 |
| Hersteller Artikelnummer: |
orb2131520 |
| Alternativnummer: |
BYT-ORB2131520-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human MCM7 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3 |
| MCM7 Antibody - middle region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
81kDa |
| NCBI: |
005907 |
| UniProt: |
P33993 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV |
