MCM7 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131522
Artikelname: MCM7 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131522
Hersteller Artikelnummer: orb2131522
Alternativnummer: BYT-ORB2131522-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCM7
Konjugation: FITC
Alternative Synonym: MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3
MCM7 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 81kDa
NCBI: 005907
UniProt: P33993
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV