MCM6 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131523
Artikelname: MCM6 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131523
Hersteller Artikelnummer: orb2131523
Alternativnummer: BYT-ORB2131523-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MCM6
Konjugation: Biotin
Alternative Synonym: Mis5, P105MCM, MCG40308
MCM6 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 90kDa
UniProt: Q14566
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLC