MCM6 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131526
Artikelname: MCM6 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131526
Hersteller Artikelnummer: orb2131526
Alternativnummer: BYT-ORB2131526-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6
Konjugation: Biotin
Alternative Synonym: Mis5, P105MCM, MCG40308
MCM6 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 005906
UniProt: Q14566
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE