MCM2 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2131541
Artikelname: MCM2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2131541
Hersteller Artikelnummer: orb2131541
Alternativnummer: BYT-ORB2131541-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCM2
Konjugation: Biotin
Alternative Synonym: BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN
MCM2 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 004517
UniProt: P49736
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL