A synthetic peptide corresponding to a sequence in the middle region of human Bmi1 (135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Konjugation:
Unconjugated
Alternative Synonym:
Polycomb complex protein BMI-1,Polycomb group RING finger protein 4,RING finger protein 51,BMI1,PCGF4, RNF51,
Bmi1 Antibody
Klonalität:
Polyclonal
Konzentration:
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
WB: The detection limit for Bmi1 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
