RUNX2 Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: RUNX2 Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB215912
• Hersteller Artikelnummer: orb215912
• Alternativnummer: BYT-ORB215912-10,BYT-ORB215912-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC, IF, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2 (244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
• Konjugation: Unconjugated
• Alternative Synonym: Runt-related transcription factor 2,Acute myeloid leukemia 3 protein,Core-binding factor subunit alpha-1,CBF-alpha-1,Oncogene AML-3,Osteoblast-specific transcription factor 2,OSF-2,Polyomavirus enhancer-binding protein 2 alpha A subunit,PEA2-alpha A,PEBP

Produktbeschreibung

RUNX2 Antibody

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molekulargewicht: 56 kDa
• Sensitivitaet: < 5pg/ml
• UniProt: Q13950
• Formulierung: Lyophilized

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: The detection limit for RUNX2 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0