CLEC7A Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2252615
Artikelname: |
CLEC7A Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2252615 |
Hersteller Artikelnummer: |
orb2252615 |
Alternativnummer: |
BYT-ORB2252615-25 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse CLEC7A |
Konjugation: |
Unconjugated |
Alternative Synonym: |
BG, BGR, beta-, Clecsf, dectin, beta-GR, Clecsf12 |
CLEC7A Antibody - N-terminal region |
Klonalität: |
Polyclonal |
Molekulargewicht: |
26 kDa |
UniProt: |
Q6QLQ4 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: SHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILC |