TMPRSS2 (Human) Recombinant Protein (Q01)
Artikelnummer:
BYT-ORB2286412
| Artikelname: |
TMPRSS2 (Human) Recombinant Protein (Q01) |
| Artikelnummer: |
BYT-ORB2286412 |
| Hersteller Artikelnummer: |
orb2286412 |
| Alternativnummer: |
BYT-ORB2286412-10 |
| Hersteller: |
Biorbyt |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
AP, Array, ELISA, WB |
| Human TMPRSS2 partial ORF ( NP_005647, 383 a.a. - 492 a.a.) recombinant protein with GST-tag at N-terminal. |
| Klonalität: |
Recombinant |
| NCBI: |
005647 |
| Puffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequenz: |
GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| Anwendungsbeschreibung: |
Best use within three months from the date of receipt of this protein. |
