E.coli fbpB protein

Artikelnummer: BYT-ORB246482
Artikelname: E.coli fbpB protein
Artikelnummer: BYT-ORB246482
Hersteller Artikelnummer: orb246482
Alternativnummer: BYT-ORB246482-20, BYT-ORB246482-100, BYT-ORB246482-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: fbpB
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B
Molekulargewicht: 46.7 kDa
UniProt: P9WQP0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVF
Anwendungsbeschreibung: Full length of His-SUMO-tag and expression region is 41-325aa