E.coli ply protein

Artikelnummer: BYT-ORB246483
Artikelname: E.coli ply protein
Artikelnummer: BYT-ORB246483
Hersteller Artikelnummer: orb246483
Alternativnummer: BYT-ORB246483-20, BYT-ORB246483-100, BYT-ORB246483-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ply
Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin
Molekulargewicht: 68.8 kDa
UniProt: P0C2J9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSK
Anwendungsbeschreibung: Full length of His-SUMO-tag and expression region is 2-471aa