TMPRSS2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325283
Artikelname: TMPRSS2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325283
Hersteller Artikelnummer: orb325283
Alternativnummer: BYT-ORB325283-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPS2
Konjugation: Unconjugated
Alternative Synonym: anti TMPRSS2 antibody, anti PRSS10 antibody, anti antibody
Rabbit polyclonal antibody to TMPS2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 54kDa
NCBI: 005647
UniProt: O15393
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM
Target-Kategorie: TMPRSS2
Sample Type: Fetal Liver lysates, Antibody Dilution: 1 ug/mL.