MSI2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB577913
| Artikelname: |
MSI2 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB577913 |
| Hersteller Artikelnummer: |
orb577913 |
| Alternativnummer: |
BYT-ORB577913-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
MSI2H |
| Rabbit polyclonal antibody to MSI2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
35 kDa |
| NCBI: |
620412 |
| UniProt: |
Q96DH6 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL |
| Target-Kategorie: |
MSI2 |
