SF4 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577937
Artikelname: SF4 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577937
Hersteller Artikelnummer: orb577937
Alternativnummer: BYT-ORB577937-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SF4
Konjugation: Unconjugated
Alternative Synonym: RBP, SF4, F23858
Rabbit polyclonal antibody to SF4
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 72kDa
NCBI: 757386
UniProt: Q8IWZ8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK
Target-Kategorie: SUGP1