Dnd1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577950
Artikelname: Dnd1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577950
Hersteller Artikelnummer: orb577950
Alternativnummer: BYT-ORB577950-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Dnd1
Konjugation: Unconjugated
Rabbit polyclonal antibody to Dnd1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 38kDa
NCBI: 001102849
UniProt: D3ZQ06
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM
Target-Kategorie: Dnd1