RBPMS2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577953
Artikelname: RBPMS2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577953
Hersteller Artikelnummer: orb577953
Alternativnummer: BYT-ORB577953-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBPMS2
Konjugation: Unconjugated
Rabbit polyclonal antibody to RBPMS2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 22kDa
NCBI: 919248
UniProt: Q6ZRY4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW
Target-Kategorie: RBPMS2