SYNJ1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577964
Artikelname: SYNJ1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577964
Hersteller Artikelnummer: orb577964
Alternativnummer: BYT-ORB577964-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SYNJ1
Konjugation: Unconjugated
Alternative Synonym: DEE53, EIEE53, INPP5G, PARK20
Rabbit polyclonal antibody to SYNJ1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 173 kDa
NCBI: 003886
UniProt: O43426
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
Target-Kategorie: SYNJ1