C6orf201 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577965
Artikelname: C6orf201 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577965
Hersteller Artikelnummer: orb577965
Alternativnummer: BYT-ORB577965-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf201
Konjugation: Unconjugated
Alternative Synonym: dJ1013A10.5
Rabbit polyclonal antibody to C6orf201
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 14kDa
NCBI: 66986
UniProt: Q7Z4U5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG
Target-Kategorie: C6orf201