WNT10B antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577968
Artikelname: WNT10B antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577968
Hersteller Artikelnummer: orb577968
Alternativnummer: BYT-ORB577968-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT10B
Konjugation: Unconjugated
Alternative Synonym: SHFM6, STHAG8, WNT-12
Rabbit polyclonal antibody to WNT10B
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 40kDa
NCBI: 003385
UniProt: O00744
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
Target-Kategorie: WNT10B