FZD5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB577972
Artikelname: FZD5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB577972
Hersteller Artikelnummer: orb577972
Alternativnummer: BYT-ORB577972-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FZD5
Konjugation: Unconjugated
Alternative Synonym: HFZ5, C2orf31
Rabbit polyclonal antibody to FZD5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 65 kDa
NCBI: 003459
UniProt: Q13467
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH
Target-Kategorie: FZD5