Doublecortin antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578005
Artikelname: Doublecortin antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578005
Hersteller Artikelnummer: orb578005
Alternativnummer: BYT-ORB578005-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DCX
Konjugation: Unconjugated
Alternative Synonym: DC, DBCN, LISX, SCLH, XLIS
Rabbit polyclonal antibody to Doublecortin
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 40kDa
NCBI: 835365
UniProt: O43602
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
Target-Kategorie: DCX