PIWIL1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578009
Artikelname: PIWIL1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578009
Hersteller Artikelnummer: orb578009
Alternativnummer: BYT-ORB578009-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIWIL1
Konjugation: Unconjugated
Alternative Synonym: HIWI, MIWI, PIWI, CT80.1
Rabbit polyclonal antibody to PIWIL1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 98kDa
NCBI: 004755
UniProt: Q96J94
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
Target-Kategorie: PIWIL1