MSH2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578016
Artikelname: MSH2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578016
Hersteller Artikelnummer: orb578016
Alternativnummer: BYT-ORB578016-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MSH2
Konjugation: Unconjugated
Alternative Synonym: FCC1, COCA1, HNPCC, LCFS2, hMSH2, HNPCC1, MMRCS2
Rabbit polyclonal antibody to MSH2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 105kDa
NCBI: 000242
UniProt: P43246
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
Target-Kategorie: MSH2