ELAC1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578017
Artikelname: ELAC1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578017
Hersteller Artikelnummer: orb578017
Alternativnummer: BYT-ORB578017-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELAC1
Konjugation: Unconjugated
Alternative Synonym: D29
Rabbit polyclonal antibody to ELAC1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 40kDa
NCBI: 061166
UniProt: Q9H777
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
Target-Kategorie: ELAC1