ALDOB antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578019
Artikelname: ALDOB antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578019
Hersteller Artikelnummer: orb578019
Alternativnummer: BYT-ORB578019-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDOB
Konjugation: Unconjugated
Alternative Synonym: ALDB, ALDO2
Rabbit polyclonal antibody to ALDOB
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 39kDa
NCBI: 000026
UniProt: P05062
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ
Target-Kategorie: ALDOB